Anti-Aquaporin 1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89041-100
Artikelname: Anti-Aquaporin 1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89041-100
Hersteller Artikelnummer: A89041-100
Alternativnummer: ABC-A89041-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Aquaporin-1 (Aquaporin-1 (AQP1)) (NP_932766.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Aquaporin 1.
Klonalität: Polyclonal
Molekulargewicht: 25 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Target-Kategorie: Aquaporin 1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200