Anti-DN-7 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89044-50
Artikelname: Anti-DN-7 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89044-50
Hersteller Artikelnummer: A89044-50
Alternativnummer: ABC-A89044-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF9B (NP_057059.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to DN-7.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA
Target-Kategorie: DN-7
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000