Anti-NUBP2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89046-100
Artikelname: Anti-NUBP2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89046-100
Hersteller Artikelnummer: A89046-100
Alternativnummer: ABC-A89046-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 142-271 of human NUBP2 (NP_036357.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NUBP2.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGGGEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKILDATPACLP
Target-Kategorie: NUBP2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000