Anti-Kallikrein 12 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89047-50
Artikelname: Anti-Kallikrein 12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89047-50
Hersteller Artikelnummer: A89047-50
Alternativnummer: ABC-A89047-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human KLK12 (NP_062544.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Kallikrein 12.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNH
Target-Kategorie: Kallikrein 12
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000