Anti-XRCC6BP1 / KUB3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89059-100
Artikelname: Anti-XRCC6BP1 / KUB3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89059-100
Hersteller Artikelnummer: A89059-100
Alternativnummer: ABC-A89059-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human ATP23 (NP_150592.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to XRCC6BP1 / KUB3.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI
Target-Kategorie: XRCC6BP1 / KUB3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:3,000