Anti-Myf5 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89065-100
Artikelname: Anti-Myf5 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89065-100
Hersteller Artikelnummer: A89065-100
Alternativnummer: ABC-A89065-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 143-220 of human MYF5 (NP_005584.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Myf5.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQP
Target-Kategorie: Myf5
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000