Anti-CEBP Delta / CEBPD Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89067-100
Artikelname: Anti-CEBP Delta / CEBPD Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89067-100
Hersteller Artikelnummer: A89067-100
Alternativnummer: ABC-A89067-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CEBP Delta/CEBPD (NP_005186.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CEBP Delta / CEBPD.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: PAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLA
Target-Kategorie: CEBP Delta / CEBPD
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000