Anti-PIP4P2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89071-100
Artikelname: Anti-PIP4P2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89071-100
Hersteller Artikelnummer: A89071-100
Alternativnummer: ABC-A89071-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-195 of human TMEM55A (NP_061180.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PIP4P2.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: VMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAY
Target-Kategorie: PIP4P2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000