Anti-MLF2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89074-50
Artikelname: Anti-MLF2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89074-50
Hersteller Artikelnummer: A89074-50
Alternativnummer: ABC-A89074-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MLF2.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVS
Target-Kategorie: MLF2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:100-1:200