Anti-CD99L2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89079-50
Artikelname: Anti-CD99L2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89079-50
Hersteller Artikelnummer: A89079-50
Alternativnummer: ABC-A89079-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-185 of human CD99L2 (NP_113650.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CD99L2.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPG
Target-Kategorie: CD99L2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000