Anti-PANDER Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89081-100
Artikelname: Anti-PANDER Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89081-100
Hersteller Artikelnummer: A89081-100
Alternativnummer: ABC-A89081-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-235 of human FAM3B (NP_478066.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PANDER.
Klonalität: Polyclonal
Molekulargewicht: 28 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Target-Kategorie: PANDER
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000