Anti-Desmin Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89616-100
Artikelname: Anti-Desmin Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89616-100
Hersteller Artikelnummer: A89616-100
Alternativnummer: ABC-A89616-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-470 of human Desmin (NP_001918.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Desmin.
Klonalität: Polyclonal
Molekulargewicht: 55 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: DFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTND
Target-Kategorie: Desmin
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500