Anti-Myeloid leukemia factor 1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89620-100
Artikelname: Anti-Myeloid leukemia factor 1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89620-100
Hersteller Artikelnummer: A89620-100
Alternativnummer: ABC-A89620-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-268 of human MLF1 (NP_071888.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Myeloid leukemia factor 1.
Klonalität: Polyclonal
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGD
Target-Kategorie: Myeloid leukemia factor 1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200