Anti-SLC25A20 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89624-100
Artikelname: Anti-SLC25A20 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89624-100
Hersteller Artikelnummer: A89624-100
Alternativnummer: ABC-A89624-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC25A20 (NP_000378.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SLC25A20.
Klonalität: Polyclonal
Molekulargewicht: 33 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQ
Target-Kategorie: SLC25A20
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500