Anti-PPP1A / PPP1CA Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89631-100
Artikelname: Anti-PPP1A / PPP1CA Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89631-100
Hersteller Artikelnummer: A89631-100
Alternativnummer: ABC-A89631-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human PPP1CA (NP_002699.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PPP1A / PPP1CA.
Klonalität: Polyclonal
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDG
Target-Kategorie: PPP1A / PPP1CA
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200