Anti-VPS26 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89653-100
Artikelname: Anti-VPS26 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89653-100
Hersteller Artikelnummer: A89653-100
Alternativnummer: ABC-A89653-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 208-327 of human VPS26A (NP_004887.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to VPS26.
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: ELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM
Target-Kategorie: VPS26
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, ICC/IF: 1:50-1:200