Anti-KCNK3 / TASK1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89655-100
Artikelname: Anti-KCNK3 / TASK1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89655-100
Hersteller Artikelnummer: A89655-100
Alternativnummer: ABC-A89655-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-394 of human KCNK3 (NP_002237.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to KCNK3 / TASK1.
Klonalität: Polyclonal
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: NAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
Target-Kategorie: KCNK3 / TASK1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200