Anti-GPCR GPR6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89656-100
Artikelname: Anti-GPCR GPR6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89656-100
Hersteller Artikelnummer: A89656-100
Alternativnummer: ABC-A89656-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 253-362 of human GPR6 (NP_005275.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GPCR GPR6.
Klonalität: Polyclonal
Molekulargewicht: 38 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: WRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV
Target-Kategorie: GPCR GPR6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100