Anti-c-Maf Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89660-100
Artikelname: Anti-c-Maf Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89660-100
Hersteller Artikelnummer: A89660-100
Alternativnummer: ABC-A89660-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to c-Maf.
Klonalität: Polyclonal
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Target-Kategorie: c-Maf
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000