Anti-OMA1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89663-100
Artikelname: Anti-OMA1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89663-100
Hersteller Artikelnummer: A89663-100
Alternativnummer: ABC-A89663-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 360-524 of human OMA1 (NP_660286.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to OMA1.
Klonalität: Polyclonal
Molekulargewicht: 37 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Target-Kategorie: OMA1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100