Anti-Caspase-12 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89676-100
Artikelname: Anti-Caspase-12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89676-100
Hersteller Artikelnummer: A89676-100
Alternativnummer: ABC-A89676-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-12 (NP_001177945.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Caspase-12.
Klonalität: Polyclonal
Molekulargewicht: 55 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: FNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASADTHGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS
Target-Kategorie: Caspase-12
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200