Anti-HAP40 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A89677-100
| Artikelname: |
Anti-HAP40 Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A89677-100 |
| Hersteller Artikelnummer: |
A89677-100 |
| Alternativnummer: |
ABC-A89677-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human F8A1 (NP_036283.2). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to HAP40. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
39 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Formulierung: |
Liquid |
| Sequenz: |
AALRDLGQPAAAAGHFQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGSHPVQSLPPPPPPAPQPGPGATPALPAALLPPNSG |
| Target-Kategorie: |
HAP40 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000 |
