Anti-VIP36 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89698-100
Artikelname: Anti-VIP36 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89698-100
Hersteller Artikelnummer: A89698-100
Alternativnummer: ABC-A89698-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 190-320 of human LMAN2 (NP_006807.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to VIP36.
Klonalität: Polyclonal
Molekulargewicht: 39 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: HSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTG
Target-Kategorie: VIP36
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:200-1:2,000, ICC/IF: 1:50-1:200