Anti-Cdk7 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89700-100
Artikelname: Anti-Cdk7 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89700-100
Hersteller Artikelnummer: A89700-100
Alternativnummer: ABC-A89700-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Cdk7.
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
Target-Kategorie: Cdk7
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200