Anti-Melatonin Receptor 1A / MTNR1A Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89707-100
Artikelname: Anti-Melatonin Receptor 1A / MTNR1A Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89707-100
Hersteller Artikelnummer: A89707-100
Alternativnummer: ABC-A89707-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 281-350 of human MTNR1A (NP_005949.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Melatonin Receptor 1A / MTNR1A.
Klonalität: Polyclonal
Molekulargewicht: 39 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: YYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV
Target-Kategorie: Melatonin Receptor 1A / MTNR1A
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:5,000, IHC: 1:100-1:200