Anti-Prostaglandin F2 alpha Receptor / PTGFR Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89717-50
Artikelname: Anti-Prostaglandin F2 alpha Receptor / PTGFR Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89717-50
Hersteller Artikelnummer: A89717-50
Alternativnummer: ABC-A89717-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PTGFR (NP_000950.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Prostaglandin F2 alpha Receptor / PTGFR.
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: ILMKAYQRFRQKSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKPIFHSTKITSK
Target-Kategorie: Prostaglandin F2 alpha Receptor / PTGFR
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000