Anti-Ribonuclease 3 / ECP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A8972-100
Artikelname: Anti-Ribonuclease 3 / ECP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A8972-100
Hersteller Artikelnummer: A8972-100
Alternativnummer: ABC-A8972-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 28-160 of human RNASE3 (NP_002926.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Ribonuclease 3 / ECP.
Klonalität: Polyclonal
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
Target-Kategorie: Ribonuclease 3 / ECP
Antibody Type: Primary Antibody
Application Verdünnung: IHC: 1:50-1:100