Anti-GPCR GPR55 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89744-50
Artikelname: Anti-GPCR GPR55 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89744-50
Hersteller Artikelnummer: A89744-50
Alternativnummer: ABC-A89744-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-319 of human GPR55 (NP_005674.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GPCR GPR55.
Klonalität: Polyclonal
Molekulargewicht: 37 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: GRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
Target-Kategorie: GPCR GPR55
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200