Anti-Alcohol Dehydrogenase Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89745-100
Artikelname: Anti-Alcohol Dehydrogenase Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89745-100
Hersteller Artikelnummer: A89745-100
Alternativnummer: ABC-A89745-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Alcohol Dehydrogenase (NP_000658.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Alcohol Dehydrogenase.
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: IIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
Target-Kategorie: Alcohol Dehydrogenase
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000