Anti-ST8SIA1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89753-100
Artikelname: Anti-ST8SIA1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89753-100
Hersteller Artikelnummer: A89753-100
Alternativnummer: ABC-A89753-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 49-270 of human ST8SIA1 (NP_003025.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to ST8SIA1.
Klonalität: Polyclonal
Molekulargewicht: 40 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHA
Target-Kategorie: ST8SIA1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000