Anti-FA2H Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A89757-100
| Artikelname: |
Anti-FA2H Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ABC-A89757-100 |
| Hersteller Artikelnummer: |
A89757-100 |
| Alternativnummer: |
ABC-A89757-100 |
| Hersteller: |
Antibodies.com |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 95-170 of human FA2H (NP_077282.3). |
| Konjugation: |
Unconjugated |
| Rabbit polyclonal antibody to FA2H. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
40 kDa |
| Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Formulierung: |
Liquid |
| Sequenz: |
NEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWY |
| Target-Kategorie: |
FA2H |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB: 1:500-1:2,000 |
