Anti-FOXQ1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89762-100
Artikelname: Anti-FOXQ1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89762-100
Hersteller Artikelnummer: A89762-100
Alternativnummer: ABC-A89762-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FOXQ1 (NP_150285.3).
Konjugation: Unconjugated
Rabbit polyclonal antibody to FOXQ1.
Klonalität: Polyclonal
Molekulargewicht: 41 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNS
Target-Kategorie: FOXQ1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000