Anti-p38 alpha / MAPK14 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89763-100
Artikelname: Anti-p38 alpha / MAPK14 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89763-100
Hersteller Artikelnummer: A89763-100
Alternativnummer: ABC-A89763-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to p38 alpha / MAPK14.
Klonalität: Polyclonal
Molekulargewicht: 41 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Target-Kategorie: p38 alpha / MAPK14
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200