Anti-5HT1F Receptor Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89833-50
Artikelname: Anti-5HT1F Receptor Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89833-50
Hersteller Artikelnummer: A89833-50
Alternativnummer: ABC-A89833-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-290 of human HTR1F (NP_000857.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to 5HT1F Receptor.
Klonalität: Polyclonal
Molekulargewicht: 42 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: LYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERK
Target-Kategorie: 5HT1F Receptor
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000