Anti-Biglycan Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A89834-100
Artikelname: |
Anti-Biglycan Antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
ABC-A89834-100 |
Hersteller Artikelnummer: |
A89834-100 |
Alternativnummer: |
ABC-A89834-100 |
Hersteller: |
Antibodies.com |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 20-230 of human BGN (NP_001702.1). |
Konjugation: |
Unconjugated |
Rabbit polyclonal antibody to Biglycan. |
Klonalität: |
Polyclonal |
Molekulargewicht: |
42 kDa |
Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
Formulierung: |
Liquid |
Sequenz: |
EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPET |
Target-Kategorie: |
Biglycan |
Antibody Type: |
Primary Antibody |
Application Verdünnung: |
WB: 1:500-1:1,000 |