Anti-p38 gamma / MAPK12 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89839-50
Artikelname: Anti-p38 gamma / MAPK12 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89839-50
Hersteller Artikelnummer: A89839-50
Alternativnummer: ABC-A89839-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 248-367 of human MAPK12 (NP_002960.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to p38 gamma / MAPK12.
Klonalität: Polyclonal
Molekulargewicht: 42 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: EFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Target-Kategorie: p38 gamma / MAPK12
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:2,000-1:5,000, IHC: 1:50-1:200