Anti-NPHS2 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89854-50
Artikelname: Anti-NPHS2 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89854-50
Hersteller Artikelnummer: A89854-50
Alternativnummer: ABC-A89854-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-388 of human NPHS2 (NP_055440.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to NPHS2.
Klonalität: Polyclonal
Molekulargewicht: 42 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML
Target-Kategorie: NPHS2
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000