Anti-VEGFA Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89855-50
Artikelname: Anti-VEGFA Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89855-50
Hersteller Artikelnummer: A89855-50
Alternativnummer: ABC-A89855-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 27-126AA of human VEGFA (NP_001165099.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to VEGFA.
Klonalität: Polyclonal
Molekulargewicht: 23 kDa / 27 kDa / 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN
Target-Kategorie: VEGFA
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, ICC/IF: 1:50-1:200