Anti-SLC14A1 / UTE Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89857-100
Artikelname: Anti-SLC14A1 / UTE Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89857-100
Hersteller Artikelnummer: A89857-100
Alternativnummer: ABC-A89857-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human SLC14A1 (NP_001295208.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to SLC14A1 / UTE.
Klonalität: Polyclonal
Molekulargewicht: 35 - 45 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Formulierung: Liquid
Sequenz: QIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEDIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL
Target-Kategorie: SLC14A1 / UTE
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200