Anti-Creatine Kinase MB Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89876-50
Artikelname: Anti-Creatine Kinase MB Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89876-50
Hersteller Artikelnummer: A89876-50
Alternativnummer: ABC-A89876-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 182-381 of human Creatine kinase B type (Creatine kinase B type (CKB)) (NP_001814.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Creatine Kinase MB.
Klonalität: Polyclonal
Molekulargewicht: 43 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Target-Kategorie: Creatine Kinase MB
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:1,000-1:2,000