Anti-MASPIN Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89880-100
Artikelname: Anti-MASPIN Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89880-100
Hersteller Artikelnummer: A89880-100
Alternativnummer: ABC-A89880-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-189 of human SERPINB5 (NP_002630.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to MASPIN.
Klonalität: Polyclonal
Molekulargewicht: 43 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: EKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNK
Target-Kategorie: MASPIN
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, IHC: 1:50-1:200