Anti-S1P1 / EDG1 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89888-100
Artikelname: Anti-S1P1 / EDG1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89888-100
Hersteller Artikelnummer: A89888-100
Alternativnummer: ABC-A89888-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 303-382 of human EDG1/HEXIM1 (NP_001391.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to S1P1 / EDG1.
Klonalität: Polyclonal
Molekulargewicht: 43 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: NSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Target-Kategorie: S1P1 / EDG1
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000