Anti-Dopamine Receptor D3 / DRD3 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89896-100
Artikelname: Anti-Dopamine Receptor D3 / DRD3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89896-100
Hersteller Artikelnummer: A89896-100
Alternativnummer: ABC-A89896-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D3 (Dopamine Receptor D3 (DRD3)) (NP_000787.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to Dopamine Receptor D3 / DRD3.
Klonalität: Polyclonal
Molekulargewicht: 44 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR
Target-Kategorie: Dopamine Receptor D3 / DRD3
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000