Anti-Dopamine Receptor D3 / DRD3 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A89896-100
Artikelname: |
Anti-Dopamine Receptor D3 / DRD3 Antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
ABC-A89896-100 |
Hersteller Artikelnummer: |
A89896-100 |
Alternativnummer: |
ABC-A89896-100 |
Hersteller: |
Antibodies.com |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dopamine Receptor D3 (Dopamine Receptor D3 (DRD3)) (NP_000787.2). |
Konjugation: |
Unconjugated |
Rabbit polyclonal antibody to Dopamine Receptor D3 / DRD3. |
Klonalität: |
Polyclonal |
Molekulargewicht: |
44 kDa |
Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
Formulierung: |
Liquid |
Sequenz: |
MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR |
Target-Kategorie: |
Dopamine Receptor D3 / DRD3 |
Antibody Type: |
Primary Antibody |
Application Verdünnung: |
WB: 1:500-1:2,000 |