Anti-TAZ Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89897-100
Artikelname: Anti-TAZ Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89897-100
Hersteller Artikelnummer: A89897-100
Alternativnummer: ABC-A89897-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TAZ (NP_056287.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TAZ.
Klonalität: Polyclonal
Molekulargewicht: 55 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Formulierung: Liquid
Sequenz: LNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Target-Kategorie: TAZ
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200