Anti-GATA4 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A89898-50
Artikelname: Anti-GATA4 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A89898-50
Hersteller Artikelnummer: A89898-50
Alternativnummer: ABC-A89898-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-442 of human GATA4 (NP_002043.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to GATA4.
Klonalität: Polyclonal
Molekulargewicht: 50 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: SSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Target-Kategorie: GATA4
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:1,000, IHC: 1:50-1:200