Anti-AGPAT7 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90559-100
Artikelname: Anti-AGPAT7 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90559-100
Hersteller Artikelnummer: A90559-100
Alternativnummer: ABC-A90559-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 345-524 of human LPCAT4 (NP_705841.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to AGPAT7.
Klonalität: Polyclonal
Molekulargewicht: 57 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: AGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQAEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
Target-Kategorie: AGPAT7
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000