Anti-TGF beta Receptor I Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ABC-A90567-50
Artikelname: |
Anti-TGF beta Receptor I Antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
ABC-A90567-50 |
Hersteller Artikelnummer: |
A90567-50 |
Alternativnummer: |
ABC-A90567-50 |
Hersteller: |
Antibodies.com |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TGF beta Receptor I (TGFBR1) (NP_004603.1). |
Konjugation: |
Unconjugated |
Rabbit polyclonal antibody to TGF beta Receptor I. |
Klonalität: |
Polyclonal |
Molekulargewicht: |
56 kDa |
Puffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
Formulierung: |
Liquid |
Sequenz: |
CCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRT |
Target-Kategorie: |
TGF beta Receptor I |
Antibody Type: |
Primary Antibody |
Application Verdünnung: |
WB: 1:500-1:1,000 |