Anti-PGCP Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90569-50
Artikelname: Anti-PGCP Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90569-50
Hersteller Artikelnummer: A90569-50
Alternativnummer: ABC-A90569-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CPQ (NP_057218.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to PGCP.
Klonalität: Polyclonal
Molekulargewicht: 57 - 60 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGL
Target-Kategorie: PGCP
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000