Anti-TN-X Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A9057-100
Artikelname: Anti-TN-X Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A9057-100
Hersteller Artikelnummer: A9057-100
Alternativnummer: ABC-A9057-100
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 444-673 of human TNXB (NP_115859.2).
Konjugation: Unconjugated
Rabbit polyclonal antibody to TN-X.
Klonalität: Polyclonal
Molekulargewicht: 69 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: TSFTTGGLRIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG
Target-Kategorie: TN-X
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:500-1:2,000