Anti-CDC2L6 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ABC-A90570-50
Artikelname: Anti-CDC2L6 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ABC-A90570-50
Hersteller Artikelnummer: A90570-50
Alternativnummer: ABC-A90570-50
Hersteller: Antibodies.com
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CDK19 (XP_005266928.1).
Konjugation: Unconjugated
Rabbit polyclonal antibody to CDC2L6.
Klonalität: Polyclonal
Molekulargewicht: 57 kDa
Puffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Formulierung: Liquid
Sequenz: QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS
Target-Kategorie: CDC2L6
Antibody Type: Primary Antibody
Application Verdünnung: WB: 1:100-1:500, IHC: 1:50-1:200